PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta011379
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family NF-YC
Protein Properties Length: 198aa    MW: 22267.3 Da    PI: 5.0239
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-88082547PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC159.26.4e-50721668102
      NF-YC   8 kqiekatdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdelk 102
                +++e++++fk+h+lPlarikki+k+dedvkmisaeaPvl+skacelfileltlrswlh+eenkrrtl+++dia a++r d+ dfl+divprde+k
  Pta011379  72 EEMEQVAEFKQHQLPLARIKKIMKSDEDVKMISAEAPVLFSKACELFILELTLRSWLHTEENKRRTLQRNDIAGAISRGDVLDFLLDIVPRDEVK 166
                68******************************************************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471138.89E-3072156IPR009072Histone-fold
Gene3DG3DSA:1.10.20.108.8E-3775147IPR009072Histone-fold
PfamPF008085.1E-2184147IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MEGNYPHLQS SATPPVSHGP SSLMHNSLFQ QQQPQMPLQH HQQQLQGVNA ASSPLHADPE  60
TAAADVLATA DEEMEQVAEF KQHQLPLARI KKIMKSDEDV KMISAEAPVL FSKACELFIL  120
ELTLRSWLHT EENKRRTLQR NDIAGAISRG DVLDFLLDIV PRDEVKDVMA AQQTMSQQLM  180
SQQPLMPDQP LMYQPPQQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_C4e-4277162994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT GAMMA
4csr_B4e-4277162994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT GAMMA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1134140RRTLQRN
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.115630.0root| xylem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA9NUT02e-87A9NUT0_PICSI; Putative uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G48590.12e-55nuclear factor Y, subunit C1